DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG31087

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001262952.1 Gene:CG31087 / 43062 FlyBaseID:FBgn0051087 Length:417 Species:Drosophila melanogaster


Alignment Length:380 Identity:94/380 - (24%)
Similarity:166/380 - (43%) Gaps:64/380 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLP 107
            ||.|.::..|:.:     ..|..|....::|.::||...|.....:...:..|:.|...|..:||
  Fly    52 GDNYSTQFLRLLV-----EVELIDHSTKDLSFVLKAQHSNEMMAAILAKLKLFQKEEQMYHSILP 111

  Fly   108 AIEAFQ----KSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALL 168
            ..|...    |..|.|||.  .::.|.|     || |:|.|||:..:.::...|...:.|:....
  Fly   112 KFEKLYADAGKPIQFAPKA--FKFDRDL-----GV-DYILLEDLHRKNFKNANRLAGLDLDHMHK 168

  Fly   169 TMRTLGRFHGVALAF---NALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVATDA-VKQI 229
            .:..|..||..:..:   :.|..:.|....       :.|..|:      ||.|..|:.| :.|:
  Fly   169 VLEKLAAFHAASACYVEHHGLFGEEFTVGV-------FSESNRQ------LLQEFNASGAFLAQL 220

  Fly   230 --YPNSK--YETVA--TNFLQPPLFDDLINLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSEEII 288
              :.|::  ||.:|  .::|...|..|  ...:|| :.:|..|||||..|.:.:::..|..:|.:
  Fly   221 KKWKNAQKIYEKLADSDDYLVDRLLQD--QQYNTR-EFNVLNHGDCWANNVMYQHDAFGTIKETL 282

  Fly   289 IIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIISWESLQ 353
            .:|||:.:..|.|.||.:.|.|..:.||:...:|.|:|.|.:   :||::|     .::.:....
  Fly   283 FVDFQVGKYGSPANDLYYLILSSAAPELKTAKFDYLVRYYFD---NLIENL-----KLLQYHRPL 339

  Fly   354 EELKNF--GRFGCGMGI-----ESLPMTMMEDDEVADLDGI------KENAILTD 395
            .:|||.  ..|..|:..     :.||:.|::....|:|:..      .:||:.|:
  Fly   340 PKLKNLHASLFRNGLAAYMVVSKVLPVVMLDKTADANLESYISDESKMKNAMFTN 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 80/310 (26%)
CG31087NP_001262952.1 EcKinase 52..335 CDD:281023 81/319 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.