DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG10550

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:362 Identity:72/362 - (19%)
Similarity:151/362 - (41%) Gaps:53/362 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLP 107
            |:.|.|.:.|:.:..:  .::|.:::   :|.|:|.|.:......:...:..|..|...|...:|
  Fly    54 GENYTSIMIRVIVDIL--LKDGSEQR---VSYILKTMLEADSGADVIDGMGLFPKERKMYEVHIP 113

  Fly   108 AIEAFQKSRQPAPKKPFVEY-PRCLASLCDGVNDFIAL--EDVGPRGYRAPVRQDYISLEDALLT 169
               .|.|..:.|..:  :|. |:||.  .|..::.|.:  ||:..:.::...|.....|......
  Fly   114 ---QFVKLYKEAGLE--IELAPKCLH--VDATDELITMVFEDLSRQNFKNFDRLKGFDLPHMREV 171

  Fly   170 MRTLGRFHGVALA-------FNAL--------DSKNFEKAAGSLEETYYGEHTREWYTGFLLLAE 219
            :|.|...|..::.       ::|:        .|::..::.|...|..:.:..|.|.      .|
  Fly   172 LRKLAELHAASVVAKEINGPYDAMYNMSIYNEQSRDLFESLGKQREEQFLKAMRNWD------LE 230

  Fly   220 NVATDAVKQIYPNSKYETVATNFLQPPLFDDLINLVSTRSKLSVFGHGDCWTPNFLTKYNERGQS 284
            |..:...:...|...:|....           :|.|. ..:.:|..|||||:.|.:..|.:.|:.
  Fly   231 NAESYIARMWDPLEVFEEAVQ-----------VNQVD-EDEFNVLNHGDCWSNNIMFNYKDNGEI 283

  Fly   285 EEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIISW 349
            :..|::|.|:.:..|.|.||.:.|.:..|.:::.:.:|..::.|.:...:.:: |...::.|.:.
  Fly   284 DRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYHQRLAECLK-LLNYSKPIPTL 347

  Fly   350 ESLQEELKNFGRFG--CGMGIESLPMTMMEDDEVADL 384
            ..|...:..:|.:|  ..||:  :..|:|..|:.|::
  Fly   348 RDLHIMMLKYGFWGPLTAMGV--MVATLMPTDKDANM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 61/314 (19%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 62/316 (20%)
APH 108..338 CDD:279908 50/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.