DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG31097

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:289 Identity:71/289 - (24%)
Similarity:112/289 - (38%) Gaps:37/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPR 129
            :|..|...|.:||.|.::....:....:.:|..|...|:..||..|...:    ....|....|:
  Fly    64 KDGSQKRKSYVVKTMLESDKGGKAVNEMRYFHKEQQMYSTYLPQFEKIYR----VAGHPVQLMPK 124

  Fly   130 CL-ASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNFEK 193
            || ....|| |.:...||:..|.:.|..|...:::|...|::|.|...|                
  Fly   125 CLEIGEIDG-NIYFIFEDLSTRNFVAADRTKGVNMEHMRLSLRKLAELH---------------- 172

  Fly   194 AAGSLEETYYGEHTREWYTGFL---LLAENVATDAVKQIYPNSKY--------ETVATNFLQPPL 247
            ||..:.:..||.:..::..||.   .:..:|....||.  |..|.        |....||.....
  Fly   173 AASVIYKERYGPYHADFDNGFARKDKIEHSVRRFEVKA--PEYKAAMKTWGIDECYLKNFPTTEQ 235

  Fly   248 FDDLI--NLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYS 310
            :..|.  :|.......:|..|||....|.|.||||.|...|.:|:|||:.:.:|...||...|..
  Fly   236 YGKLCLESLNVDPQDFNVLTHGDFSPSNILFKYNENGAPSEALILDFQICKWASPTQDLLMLIIL 300

  Fly   311 CTSQELREQHYDELLRAYLESAQDLIQDL 339
            ...::...:.:|.::|.|.|...|.::.|
  Fly   301 SARKDSSYKEFDNIVRIYWEYLIDFLRVL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 71/289 (25%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 71/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.