DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG31098

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:427 Identity:106/427 - (24%)
Similarity:174/427 - (40%) Gaps:84/427 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ISAKFSEATLDEIIRNAG-GTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEIS 73
            ::|:|.:..|.|..:... .......|....|.:...:.|.:.|.:.    ..:.|...|. :.|
  Fly    14 LTAEFLQDVLKEHFKEEQLAVTELIVKSAQVGDQAAGFASEMHRASF----NLQRGTAPKG-KFS 73

  Fly    74 VIVKAMPDN-----LHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLAS 133
            ||||..|..     .||.:|      |:.||..|.:|||.|:|..:|.....|         :|.
  Fly    74 VIVKDHPKGQTGAVAHRSKL------FKREILAYKEVLPRIQALLQSIGDQTK---------IAP 123

  Fly   134 LC----DGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKN---- 190
            .|    :....|:.|||:...|:....|...::|:..|.|:..:.:.|..: |..|.||..    
  Fly   124 TCYYTTESPEPFLILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACS-ALIAQDSPEVLEF 187

  Fly   191 FEKAAGSLEETYYGEHTREWYTGFLL----LAENVA-TDAVKQIYPNSKYETVATNFLQPPL--F 248
            |::|..|     .....|::.|.|.:    :||.|| ....::|  ..|...:|.|.||..|  |
  Fly   188 FDEAPIS-----RNPDRRDFLTFFPVNIRCVAEEVAHWKGYEEI--TEKMFNLAENVLQRALTMF 245

  Fly   249 DDLINLVSTRSKLSVFGHGDCWTPNFLTKY-NERGQSEEIIIIDFQLARCSSLALDLSFFIYSCT 312
            :      ||.....||...|.|..|.|... ||..:.::::.:|||||...|..:||::|:|...
  Fly   246 E------STGKDFRVFNLTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSL 304

  Fly   313 SQELREQHYDELLRAYLESAQDLIQDLGGNAESIISWESLQEELKNFGRFGCGMGIESLPMTMME 377
            ::.:|:.||..::|.|....|..::.|  |.:..|  .:|:|           :.||.:..::| 
  Fly   305 NENVRKVHYKYIVREYQRVLQQTLEKL--NYQGHI--PTLKE-----------IHIELIKTSLM- 353

  Fly   378 DDEVADLDGIKENAILTDIWNITPFKESAKQQRLADI 414
                    |:.....||.:    .|:|.|..:.|.|:
  Fly   354 --------GVIGATCLTPL----IFREGAGFENLEDL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 84/318 (26%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 85/318 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.