DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG13658

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:377 Identity:92/377 - (24%)
Similarity:152/377 - (40%) Gaps:63/377 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SAKFSEATLD-------EIIRNAGGTR--------H-TSYKFGPSGKKGDAYLSRVFR-ITIYGV 58
            ||:|:...:|       |:|.  |..|        | |..|..|:..:||.|.|.:|| ::.|  
  Fly     7 SAQFNADEVDAPAWLNAELIE--GALRAYEKDPELHVTDLKISPATLQGDHYASVMFRAVSHY-- 67

  Fly    59 KEAEEGQDEKQLEISVIVKAMPDNL-HRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKK 122
             ...:|...|.|    |||.||:.. |::.:..:...|:.||..|:|.||.:|...:......|.
  Fly    68 -STAKGNFSKAL----IVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKL 127

  Fly   123 PFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALD 187
                |..|:....: .:..:..||:.|:||.. :|..|.:.|:.......|.::|..::      
  Fly   128 ----YAPCIYHSLE-PHQVMIFEDLVPQGYTV-IRDRYPNKEELQKAFFKLAKWHAASM------ 180

  Fly   188 SKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVAT---------DAVKQIYPNSKY-ETVATNF 242
             |...:....|:|..||    .|.....|....|.|         |.|.::.....| |.:..|:
  Fly   181 -KVLNERPDFLKEFKYG----LWGMPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNY 240

  Fly   243 LQPPLFDDLINLVSTRSKLS---VFGHGDCWTPNFLTKYN-ERGQSEEIIIIDFQLARCSSLALD 303
            :|.  ...::....|..|.:   |..|||....|.:.:|| |.|..|:::::|||::....|::|
  Fly   241 IQQ--MSAVMEEYRTNPKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSID 303

  Fly   304 LSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIIS---WESL 352
            |.:.|:.....|.|.....|.:..|.....|.::.:|...|....   ||.:
  Fly   304 LIYSIFMVMDTEDRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 76/313 (24%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 76/314 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.