DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG14314

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:405 Identity:108/405 - (26%)
Similarity:198/405 - (48%) Gaps:31/405 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRN 97
            :::......:||.|.:.::||.:.|.:.:      .:.|.:||.|.||:::..|..::|...|||
  Fly    46 AFELAQGSDRGDNYTAALYRIKLTGKRRS------LKWEQNVICKVMPESVVAREAYKSDKLFRN 104

  Fly    98 EINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYIS 162
            |:.||..::|.:..||.|:.......|...|:|.::.    :|.:.:||:..||::...|...:|
  Fly   105 EVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYSAR----HDLLIMEDLRERGFQMSDRHKGLS 165

  Fly   163 LEDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVATDAVK 227
            ||:....:..:.:.||::||:.......|......:.|..:......||..:.   |.:..:|::
  Fly   166 LEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYY---ERLTKNAIQ 227

  Fly   228 QIY----PNSKYETVATNFLQ-PPLFDDLINLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSE-- 285
            .:.    |:|||......|.: ...|..::.|.||.|.||...|||||..|||..|:......  
  Fly   228 MVSEVLPPDSKYVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVL 292

  Fly   286 EIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLES----AQDLIQDLGGNAESI 346
            |:.::||||.|.||:|||::..:|.||::|:|:.....||:.|.|.    .|.|..:|..:.:::
  Fly   293 EVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTL 357

  Fly   347 ISWESL-QEELKNFGRFGCGMGIESLPMTMMEDDEVADLDGIKENAILTDI----WNITPFKESA 406
            ...:.| .||||.:|||..|:.::.||::....::..|:...:.:.:..|:    .|..|  ...
  Fly   358 QKLQDLFAEELKTYGRFALGLALDILPISTCSSEDAPDMYLDRSDELGEDVGAPTLNFPP--NDL 420

  Fly   407 KQQRLADIFKHAIDQ 421
            .:|::::|....:|:
  Fly   421 CRQKMSEIVIDMVDR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 89/308 (29%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 88/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26930
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
66.030

Return to query results.
Submit another query.