DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG6830

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:362 Identity:88/362 - (24%)
Similarity:162/362 - (44%) Gaps:37/362 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDN--LHRRRLFRSVIFFRNEINFYT 103
            |.||.:.|::.::.|    ||:. :|......|.|:|...||  ::    |.....|..||..|:
  Fly   515 KPGDNFASKLLKVEI----EAQL-KDNSVKTFSYILKVHSDNDAIN----FSDFNLFPKEIEVYS 570

  Fly   104 KVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALL 168
            ..:||.|.|.|.    ...|....|:......|...:::.||::.|.|::...|...:.||.:..
  Fly   571 TYVPAFERFYKD----VGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKC 631

  Fly   169 TMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVATDAVKQIYPNS 233
            |::.|.::|..:|.:..|:.....|....:    :.|.|...:.|..:   |.....::::   |
  Fly   632 TLKKLAQWHAASLKYKELNGPYSPKYNNGI----FTEQTAPIFKGMFV---NTKKSFIEEV---S 686

  Fly   234 KYETVATNFL--QPPLFDDLINLVSTRSKL-----SVFGHGDCWTPNFLTKYNERGQSEEIIIID 291
            |::.| ..:|  .|.:.|..::.:...:|:     :|..|||.|..|.:.:|...|:.:|.:::|
  Fly   687 KFDGV-DEYLHKMPEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLD 750

  Fly   292 FQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIISWESLQEEL 356
            .|:.:..:.|.||.:||.|.|..:::...:|.|:|.|.::.::..:.|..|. .|.|.:.|...|
  Fly   751 HQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNG-FIPSLKELHAIL 814

  Fly   357 KNFGRFGCGMGIESLPMTMME--DDEVAD-LDGIKEN 390
            .....|..|..:.:|.|.:.:  ||...| ..|.:||
  Fly   815 IQHPIFAAGTVLTTLSMCLNKTTDDFTTDSFLGNEEN 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 71/306 (23%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 72/307 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.