DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG33509

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:393 Identity:83/393 - (21%)
Similarity:151/393 - (38%) Gaps:64/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIE 110
            ||...:.:|:....|    ::|...||.:.|||||.  ....|.:..| |:.|...|..::..::
  Fly    37 YLGDYYALTLRYCHE----EEEIIREIELFVKAMPQ--QSAELSKESI-FQKESWLYDTLIKKLQ 94

  Fly   111 AFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGY----RAPVRQDYISLEDALLTMR 171
            |....:..         |.|:.|.    .|.:.||::..:|:    .|.:.:.::.     ..::
  Fly    95 ALSNVKWS---------PNCVYSR----KDLMVLENIKLKGFTSAGSAELNEVFVK-----PLIK 141

  Fly   172 TLGRFHGVALAFNALDSKNFEKAAGS--LEETYYGEHTREWYTGFLLLAENVATDAVKQIYPNSK 234
            ::..||..:|.:......|.....|.  ||.|...|..  |:|..|    :.....|:.:   :|
  Fly   142 SIAAFHSASLVYEHQTKTNIGHTYGDNLLEITVDSEIA--WFTTGL----SAVLAVVRSL---AK 197

  Fly   235 YETVATNFLQPPLFDDLINLVST--------RSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIID 291
            |:   .|..|..:.|.|:.::.|        :...:|..|.|.|..|........|.:   ::||
  Fly   198 YQ---GNREQSFIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSGPA---LLID 256

  Fly   292 FQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAY----LESAQDLIQDLGGNAESIISWESL 352
            ||..|.:..|.||:|.:|...|...|:|...:.:..|    |::..||     |..|.:||...|
  Fly   257 FQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDL-----GLEELVISKSEL 316

  Fly   353 QEELKNFGRFGCGMGIESLPMTMMEDDEVA-DLDGIKENAILTDIWNITPFKESAKQQRLADIFK 416
            .|..:.|..||......:..:..:..|.:. |...:..:.::.......|...:..::...|:.:
  Fly   317 LESYEEFRLFGVVYRAVAATVVKVPTDFITNDFKYVDRSKVILSYMKTNPEFATYMEECCVDVME 381

  Fly   417 HAI 419
            .|:
  Fly   382 MAL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 69/311 (22%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 62/282 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.