DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG5126

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:461 Identity:118/461 - (25%)
Similarity:188/461 - (40%) Gaps:87/461 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RHTSY----KFGPSG---------KKG-DAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMP 80
            ||..|    .||||.         ..| |.::|.::.:|: .|..||    .|:.|: |:||.|.
  Fly    13 RHLVYDIFKNFGPSASLESHSVECSNGLDGFMSALYTVTL-DVVIAE----RKRTEV-VLVKFMK 71

  Fly    81 DNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSR--QPAPKKPFVEYPRC-------LASLCD 136
            .....|....|.|.|.|||..|.::|||.|...::.  :....|.:|  |.|       :..|.:
  Fly    72 GTEEFRESSNSYIQFSNEIFAYAEILPAYENVLRTSHLESEVVKNWV--PCCYFARFGHVEGLGN 134

  Fly   137 GVNDFIALEDVGPRGY----RAPVRQDYISLEDALLTMRTLGRFHGVALAFNALD-SKNFEKAAG 196
            |....:||:.:...||    |..:|:|.:   :|::.:  :|.||.:..|...|. :.:....||
  Fly   135 GRESVLALKHLKGDGYQLGPRLTLRRDQL---EAMVGL--VGPFHALGYATKILQPNVHARLRAG 194

  Fly   197 SLEETYYGEHTREWYTGFLLLAENVATDAVKQIYPNSKYETV---------------ATNFLQPP 246
            .::..:.....:    |...:...||.|...:.|...|.:.:               ...|.||.
  Fly   195 VVDMPFVSSSGK----GIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPT 255

  Fly   247 LFDDLINLVS-----TRSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSF 306
            |..:.|...|     ..|..:.|.|||....|.|..|....:.:.|..||||..|.|:.|:||||
  Fly   256 LLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSF 320

  Fly   307 FIYSCTSQELREQHYDELLRAYLESAQDLIQ-DLGGNAESI-----------ISWESLQEELKNF 359
            |:|..|..|.|::.|.:|||.|..|..:::: .|..|...:           .|:|......|.:
  Fly   321 FMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQEYSFERFNAHFKRY 385

  Fly   360 GRFGCGMGIESLPMTMMEDDEVADLDGIKENAILTDIWNITPFKES---AKQQRLADIFK---HA 418
            ..:|..:.:..||..:..:.:.|:|..:.|    ||:......:.|   |..:...:|||   ||
  Fly   386 AFYGPMVCMHFLPWLLGTEKDCAELSRLFE----TDMHGPAFHQLSLDIAGDEANQEIFKTVRHA 446

  Fly   419 IDQGYI 424
            .:.||:
  Fly   447 YEHGYM 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 89/333 (27%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 88/328 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.