DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG7135

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:425 Identity:90/425 - (21%)
Similarity:156/425 - (36%) Gaps:113/425 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ISAKFSEATLDEIIRNAG----GTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQL 70
            ::.:|...||:..::...    |.:.|:...|     |:.|.|.::|..| ..:.||    ...:
  Fly    12 LTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRG-----GENYCSNIYRAQI-KYRNAE----SCAM 66

  Fly    71 EISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQ-------KSRQPAPKKPF-VEY 127
            |.|:|||:|||  .::.:...:..:..|..||..:.|.:||..       .:...|||..: ...
  Fly    67 ETSLIVKSMPD--EKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQ 129

  Fly   128 PRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVA------------ 180
            |          ...|.|||:...||:...||..:..:.|.|.|..|..:|.:.            
  Fly   130 P----------EQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIV 184

  Fly   181 -------LAFNALDSKNFE-----------------KAAGSLEETYYGEHTREWYTGFLLLAENV 221
                   |..:|::|:.|:                 :..|.:....|..|            |:.
  Fly   185 DRYPFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYH------------EHF 237

  Fly   222 ATDAVKQIYPNSKYETVATNFLQPPLFDDLINLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSEE 286
            ....:|.:||                         .|...:|..|||.|..|...||:.....::
  Fly   238 TERVLKAVYP-------------------------LRGNHNVLNHGDLWVNNIFFKYDAEYTVQQ 277

  Fly   287 IIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIISWES 351
            :.||||||....||..|:::|:.:....|:......||:..|..|..|.::.|..:.| :.|:|.
  Fly   278 VKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKE-LPSYED 341

  Fly   352 LQEELKNFGRFGCGMGIESLPMTMM-----EDDEV 381
            :.:|::....:|..:.....|:..|     ||:.:
  Fly   342 IMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 74/341 (22%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 75/345 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
44.060

Return to query results.
Submit another query.