DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG31380

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster


Alignment Length:402 Identity:89/402 - (22%)
Similarity:164/402 - (40%) Gaps:59/402 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ISAKFSEATLDEIIRNAGGTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQL---- 70
            ::|::.||.|....:| ...|..|....|:..||:.|.:.:.||.:......||....|.:    
  Fly     5 LTAEYLEAALRRYYQN-NELRVESMVINPALGKGENYGAILTRIHLVYSSIVEEHLIAKTVLEYE 68

  Fly    71 EISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLC 135
            :....:|..|.:::.|           |:..|.:|||.::.. ...|..||...::..|      
  Fly    69 DAETKMKKAPYDIYNR-----------ELEIYEQVLPKLQEL-AGEQLCPKILHIDRQR------ 115

  Fly   136 DGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGV-ALAFNALDSKNFEKAAGSLE 199
                ..:.:||:..:|:....|...:..:...|.:|.|.:.... |:..|.|...||  :....:
  Fly   116 ----GALIMEDLSYKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASAVLENNLLENNF--SLTEYD 174

  Fly   200 ETYYGEHTREWYTGFLLLAENVATDAVKQIYPNSKYETVATNFLQPPLFDDLIN---------LV 255
            :.::..:|..:...||...::.|    ..:...:.||..|      .|.|:|..         ..
  Fly   175 KGFFNRYTESFSAYFLGCLKSCA----NYLKTQAGYEHHA------KLLDELAPYYMGLGLRCFK 229

  Fly   256 STRSKLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQH 320
            ..::.::|..|||.||.|.:.|| |.|...::::||||.|...|..||:...:.:...:::|.:.
  Fly   230 QEQTHINVLTHGDLWTNNMMFKY-EAGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSEL 293

  Fly   321 YDELLRAYLESAQDLIQDLGGNAESIISWES--LQEELKNFGRFGCGMGIESLPMTMMEDDEVAD 383
            ..::...|.:.....:|.||...:.:.|.:.  |:.|.|.|....||:.:  ||:.:..|:..||
  Fly   294 QMKMRGVYHDVFVGELQRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLLL--LPVLLNTDETDAD 356

  Fly   384 LDGIKENAILTD 395
            .     .|:|:|
  Fly   357 F-----AALLSD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 64/311 (21%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 65/312 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.