DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and CG33301

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:326 Identity:72/326 - (22%)
Similarity:132/326 - (40%) Gaps:73/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFY 102
            |:..||:.::..:.||.:    :.:.|......:..::.:|:...:.:..:|.....:..|::.|
  Fly    33 PATGKGENFVGVMTRIYV----DYQLGDGSVVNKTYIVKQALSAEVPQAEVFFEYELYTREMDMY 93

  Fly   103 TKVLPAI-----EAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYIS 162
            ..:||.:     ||....:..|.           |...|...:.:.|||:.|..:....|...:.
  Fly    94 EFILPKLKELLQEAGLDQKLTAD-----------AITVDREYNTMILEDLAPYKFVNADRVKQLD 147

  Fly   163 LEDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVATDAVK 227
            :....||:..|.:||..::.               |:|.:....|:.:||.|.      :.|  |
  Fly   148 MAHTELTLEMLAKFHAASIV---------------LQERHPNLLTKCFYTHFF------SRD--K 189

  Fly   228 QIYPNSKYETVATNFL-----QPPL---FDDLINLVST-------------RSKLSVFGHGDCWT 271
            :.| :..:..:...||     ||.|   :.|.::.:.|             .|.|....||||||
  Fly   190 KAY-SVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLKTLNHGDCWT 253

  Fly   272 PNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQ-------ELREQHYDELLRAYL 329
            .|.:.:|::.|:...::.||||.:.|:|..:||.:|..:...:       ||.|.|| :.|:|.|
  Fly   254 TNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKESELVEHHY-KALKANL 317

  Fly   330 E 330
            |
  Fly   318 E 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 71/322 (22%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 71/322 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
33.010

Return to query results.
Submit another query.