DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and H37A05.2

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:292 Identity:65/292 - (22%)
Similarity:108/292 - (36%) Gaps:81/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFV--EYPR 129
            ||...::.:||    .||.|.:....|..|.:....|..:.::|||   .:.:|.|.::  ||..
 Worm   101 EKMKSMTSLVK----ELHNREVDMYRIIMREKPACPTVNVLSLEAF---TELSPLKAYIISEYIP 158

  Fly   130 CLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNAL--DSKNFE 192
            .|..:  |:||.|::|::.             ::.|            |:| ||:|:  .....|
 Worm   159 NLHHV--GMNDCISIEEIW-------------AVVD------------GIA-AFSAMGESMSEDE 195

  Fly   193 KAAGSLEETYYGEHTREWYTGFLLLAENVATDAVKQIYPNSKYETVATNFLQ------------- 244
            |...::.|.|..|                   |||..:.:...:.:..|.:.             
 Worm   196 KKKSTIGEIYIEE-------------------AVKYFFDDQSPDNMRKNLIMILGVAYEEKVEEA 241

  Fly   245 PPLFD---DLINLVSTRSKLSVF-------GHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSS 299
            ..:||   ....:....|::|.|       .|.|.|..|.|...:...:.|...:||||.|..||
 Worm   242 MDIFDLYCGSSEIQKNYSRVSAFLGHSPVLMHSDIWPSNLLFSLSSENKLEFKALIDFQTASLSS 306

  Fly   300 LALDLSFFIYSCTSQELREQHYDELLRAYLES 331
            ..||:.....:|.|::.|.....|:|..|.:|
 Worm   307 PGLDVGCLTVTCLSKKDRRTVQSEILDRYYKS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 65/292 (22%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 65/292 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.