DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and E02C12.12

DIOPT Version :10

Sequence 1:NP_572501.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_505432.2 Gene:E02C12.12 / 183991 WormBaseID:WBGene00017097 Length:200 Species:Caenorhabditis elegans


Alignment Length:129 Identity:29/129 - (22%)
Similarity:51/129 - (39%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 VSTRSKLSVFGHGDC-WTPNF-LTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELR 317
            |:|...|....|.|. :|..: |..|::....:..:|::| :....|:.:               
 Worm    95 VATYKLLEKMNHPDIPYTKVYGLKGYSDANDLKGFMIMEF-IPNVRSIPM--------------- 143

  Fly   318 EQHYDELLRAYLESAQDLIQDLGGNAESIISWESLQEELKNFGRFGCGMGIESLPMTMMEDDEV 381
               |:.:|      |.|||..:.|.|......|:|.||.|.|.  |....:||:...:..|:::
 Worm   144 ---YEAIL------ADDLISLVRGIATFAALGETLSEEEKAFA--GGPEYLESMFEEVFTDEQL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_572501.1 EcKL 42..340 CDD:397213 17/86 (20%)
E02C12.12NP_505432.2 Protein Kinases, catalytic domain 1..>200 CDD:473864 29/129 (22%)

Return to query results.
Submit another query.