DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and E02C12.11

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_505431.1 Gene:E02C12.11 / 183990 WormBaseID:WBGene00017096 Length:141 Species:Caenorhabditis elegans


Alignment Length:144 Identity:31/144 - (21%)
Similarity:63/144 - (43%) Gaps:24/144 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 NERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNA 343
            :|.|..:...|||:|........||||..:..|.|...|.:...|:|:.|.|:...::      .
 Worm     6 DEFGNLKLKAIIDWQGVSTLPPGLDLSRLLMGCLSAHERRERGLEMLKLYHETFNQVL------G 64

  Fly   344 ESIISWESLQEELKNFGRFGCGMGIESLPM--TMMEDDEVADLD-------------GIKENAIL 393
            :.:.|::.||:   ::..:...|.:..||:  ::.|:.:|::::             .:.|:.|.
 Worm    65 KELFSFQELQD---SYNLYYPMMAMALLPLVSSLAENSQVSEVEKAQIRFKTETKLVAMMEDLIE 126

  Fly   394 TDIWNITPFKESAK 407
            ...:|:..|.|..|
 Worm   127 VHEYNLKHFPEILK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 17/60 (28%)
E02C12.11NP_505431.1 PKc_like <1..132 CDD:304357 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.