DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and C18B10.6

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_504924.1 Gene:C18B10.6 / 182773 WormBaseID:WBGene00015963 Length:436 Species:Caenorhabditis elegans


Alignment Length:387 Identity:90/387 - (23%)
Similarity:138/387 - (35%) Gaps:98/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FPSFADISAKFSEATL----DEIIRNAGGTRH---------------TSYKFGP-------SGKK 42
            ||.|..|..||..:||    |.|:..     |               ||..||.       |..|
 Worm     6 FPFFLRILYKFKMSTLYEKSDGILET-----HVTWQDVESALQMKFRTSATFGKNKTATNISDLK 65

  Fly    43 GDAYLSRVFRITIYGVKEAEEGQDEKQLEI-----------------SVIVKAMPDNLHR-RRLF 89
            |  ::|::..|      ||:....|:.|::                 |.::|...:|.:. .:|.
 Worm    66 G--FMSKIALI------EADWQNVEENLQLPHKFAVKISSQLPYIAFSKVLKYTDENGYEDEKLK 122

  Fly    90 RSVIFFRNEINFYTKVLPAIEAFQKSRQPAPK----KPFVEYPRCLASLCDGVNDFIALEDVGPR 150
            ......|:..|...:....:|.|..:..|..|    |||.:.        :.:..:|.||.: |.
 Worm   123 YLAKILRDAHNREIETYKLLEKFNHANIPYTKIYGLKPFYDE--------NDLKGYIILEYI-PN 178

  Fly   151 GYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFL 215
            .:...:.:: |..:|.:.|:|.:..|..:.....| |.|.|...|..||  ||       |..||
 Worm   179 IHTTSMSEN-IPADDLISTIRAVATFGALGACLPA-DQKTFALGANFLE--YY-------YDTFL 232

  Fly   216 LLA--ENVATDAVKQI--YPNSKYETVATNFLQPPLFDDLINLVSTRSKLS-------VFGHGDC 269
            ..|  |::..:..|.:  ...||.|.:.      .::...|.:||..||:.       |..|||.
 Worm   233 GAAGVESILDNLRKSLSFCETSKVEKLI------DIYRHYIKIVSKFSKIDEILGFHLVPNHGDL 291

  Fly   270 WTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLES 331
            |..|.|....|.|..:...:||:|.........|:........|.|.|.|...|.|:.|.|:
 Worm   292 WQSNMLFNTEESGHLKLKALIDWQAVANLPPGFDMVRLFIGALSIEDRRQRASEFLKIYHET 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 74/323 (23%)
C18B10.6NP_504924.1 DUF1679 21..427 CDD:369592 83/372 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.