DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and dhs-27

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_508591.3 Gene:dhs-27 / 180632 WormBaseID:WBGene00000990 Length:320 Species:Caenorhabditis elegans


Alignment Length:268 Identity:54/268 - (20%)
Similarity:97/268 - (36%) Gaps:84/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 WYTGFLLLAENVATDAVKQIYPNSKYETVATNFLQPPLFDDLINLVSTRSKLS--VFGHGDCWTP 272
            |......:...|....:|.:|...|  :|..:|:.|.  .||..|..|.:.::  ..|.|..:..
 Worm     6 WSAAQFAVTSYVCVRVLKFLYIMCK--SVLVHFITPK--HDLDYLKDTWTVITGGTDGIGKAYIE 66

  Fly   273 NF-----LTKYNERGQS--------EEII----------IIDFQLARCSSLALDLSF----FIYS 310
            ..     |.|:...|::        :|::          :.||:....|:|..||..    .:.:
 Worm    67 ELCKTRGLKKFYLIGRNIDKLNNTKKELVEQHGCEVMCHVHDFEKDDLSALPKDLETLDVGILIN 131

  Fly   311 C---------TSQELREQHYDELLRAYLESA--------QDLIQDLGG---NAESIISW------ 349
            |         |..||.|....::||..|.||        .::::...|   |..|:..|      
 Worm   132 CAGIAPHIIGTLTELPEGLASKILRVNLMSAVKMTEMILPNMVKKKRGIIVNISSMTGWRPLPYL 196

  Fly   350 --------------ESLQEELKNFGRFGCGMGIESLPMTMMEDDEVADLDGIKENAILTDIWNIT 400
                          :||.:|.:     |.|:.::.| :.|:...:||..:..:.|    :|:.:|
 Worm   197 SSYPASKAALSFFSDSLSDEYR-----GTGIRVQCL-IPMLVATKVASYEAEEAN----NIFVVT 251

  Fly   401 PFKESAKQ 408
            | :..|||
 Worm   252 P-ENFAKQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 34/175 (19%)
dhs-27NP_508591.3 17beta-HSD1_like_SDR_c 48..294 CDD:187614 43/222 (19%)
adh_short 50..234 CDD:278532 33/189 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.