DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and F59B1.8

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:328 Identity:65/328 - (19%)
Similarity:125/328 - (38%) Gaps:79/328 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDY--ISLEDAL 167
            :||.:...||..:..|.|.||           |: :|:.         .:.||..|  :::::..
 Worm   138 LLPKVFFSQKFEEDNPNKGFV-----------GM-EFVE---------GSVVRHCYENVTVDELQ 181

  Fly   168 LTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVATDAVKQIYPN 232
            ..::.|.|..  ||:.:....:|.:... :.||:               |.:.::.|.:|.|:..
 Worm   182 PILKALARLQ--ALSLSTESCRNLDNGE-AFEES---------------LMDMLSEDGLKGIFDQ 228

  Fly   233 S---------KYETVATNFLQPPLFDDLINLVSTRSKLSVFG-------HGDCWTPNFLTKYNER 281
            |         |.|.:..|      ..:::||.:..:...|.|       |||.|..|.|....:.
 Worm   229 SRNIDQKLSEKVERIEQN------HKEILNLETVLNLNKVVGIDQKVICHGDLWAANILWTQTDG 287

  Fly   282 GQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESI 346
            |...: .::|:|.:...:.|.||...:.|..|...|:.|::.:|..:.....|   ::|.| .:.
 Worm   288 GFIAD-KVLDYQESHMGNPAEDLVRLLVSTISGADRQSHWEHILEQFYTYFTD---EIGSN-NAP 347

  Fly   347 ISWESLQEELKNFGRFGC-------GMGIESLPMTMMEDDEVADLDGI---KENAILTDIWNITP 401
            .:.|.|:...|.:...|.       |..:: :.:..||..:..:...|   |.:.:|.|:.|...
 Worm   348 YTLEQLKTSFKLYFPVGALTLISLFGPAVD-MKLQGMESGKAENYRRIVIEKVDCLLDDVLNFHD 411

  Fly   402 FKE 404
            |.:
 Worm   412 FNK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 50/252 (20%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 65/326 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.