DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2004 and C04F6.7

DIOPT Version :9

Sequence 1:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001379617.1 Gene:C04F6.7 / 13219936 WormBaseID:WBGene00195081 Length:447 Species:Caenorhabditis elegans


Alignment Length:335 Identity:68/335 - (20%)
Similarity:121/335 - (36%) Gaps:92/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DAYLSRVFRITI---------YGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEI 99
            |.::|::.|:.|         |.||..|....:..||.:...| ||:....:.:....:||..|:
 Worm    90 DGFVSQIMRVVIEFTNNQTKKYIVKMPETTNIKAALEKTTQQK-MPEGADEQFIGGLTMFFNREV 153

  Fly   100 NFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLE 164
            .:|     |:|          |.|.:..|:|          :.|.:....:...|.|.||...: 
 Worm   154 EYY-----AME----------KIPGLRTPKC----------YHAQQWDNGKTTGAIVMQDLEGM- 192

  Fly   165 DALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEH------TREWYTGF---LLLAEN 220
                          |::.:  .:|.|.::.| |:.......|      :.||...|   :.|.:.
 Worm   193 --------------VSVPY--YESLNLQQIA-SIGSQMLNLHLFSIGMSDEWRQKFPFPMELIDT 240

  Fly   221 VA--TDAVKQIYPNSK------YETVATNFLQPPLFDDLINLVSTRSKLSV---FGHGDCWTPNF 274
            |:  ||.|| :|.:..      :..|...:....||..::.  .:...|.:   ..|||.|..|.
 Worm   241 VSNMTDIVK-LYVSRNPELEEGFSKVEKMYQDRELFTKVLR--DSHKSLGIDDFLCHGDLWFYNL 302

  Fly   275 LTKYNERGQSEEII------IIDFQLARCSSLALDLSFFIYSCTSQELREQ--------HYDELL 325
            :  :..|....|:.      |||:|.....::..|....:..|...|:|.|        :|::|.
 Worm   303 M--WIPRKSGSEVASNHLGSIIDWQNVHTGNICEDFCHMLTFCCDTEIRRQAENTFLPYYYNQLK 365

  Fly   326 RAYLESAQDL 335
            ...:|:.:.|
 Worm   366 AKAVEAGKKL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 68/335 (20%)
C04F6.7NP_001379617.1 CHK 184..366 CDD:214734 41/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D832683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.