DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss5

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:260 Identity:75/260 - (28%)
Similarity:121/260 - (46%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GQDVAQNQSESAIEP---RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHG 82
            |:.|:...||....|   |||||.....|::|.|.|:.|...|.||..:::...|:||.||: :.
Mouse   199 GRIVSLKCSECGARPLASRIVGGQAVASGRWPWQASVMLGSRHTCGASVLAPHWVVTAAHCM-YS 262

  Fly    83 NDVVPADLWSIQAGSLLLSSDGVR----IPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIA 142
            ..:.....|.:.||  |:|...||    ..|.::|.||.|:...|: |:|:|:|::|:.|...:.
Mouse   263 FRLSRLSSWRVHAG--LVSHGAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVG 325

  Fly   143 AIQLATEDP-----PNCVAVDISGWG-----NIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLP 197
            |:.|..::.     ..|.   :||||     :......|.|:::.:..|.:...:|  |:...|.
Mouse   326 AVCLPAKEQHFPWGSQCW---VSGWGHTDPSHTHSSDTLQDTMVPLLSTYLCNSSC--MYSGALT 385

  Fly   198 ETMICLLH-SKNSGACYGDSGGPATYGG----KVVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            ..|:|..: ...:.||.||||||.....    .:||:.|  .|.||... .|..|.::::...||
Mouse   386 HRMLCAGYLDGRADACQGDSGGPLVCPSGDTWHLVGVVS--WGRGCAEPNRPGVYAKVAEFLDWI 448

  Fly   257  256
            Mouse   449  448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/240 (28%)
Tryp_SPc 37..219 CDD:238113 57/197 (29%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 4/13 (31%)
Tryp_SPc 217..448 CDD:214473 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.