DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and prss60.1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:283 Identity:88/283 - (31%)
Similarity:129/283 - (45%) Gaps:46/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLLLCGVQVILGQDVAQNQSESA-IEPRIVGGIKAKQGQFPHQISLR--LRGEHYC 62
            ||......|.||||    :.|.....|....| :..|||||:.|..|.:|.|:||.  :.|.|:|
Zfish     1 MWRFTCVSLALLLC----VQGSHSQLNVCGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFC 61

  Fly    63 GGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL-----SSDGVRI-----PVAEVIMHPN 117
            ||.:|::..|:||.||:..           |...|||:     :..||..     .|:.:.:||:
Zfish    62 GGSLINSEWVLTAAHCLPR-----------ITTSSLLVFLGKTTQQGVNTYEINRTVSVITVHPS 115

  Fly   118 YAT-GGHNDLAVLRLQSPLTFDANIAAIQLATEDP--PNCVAVDISGWGNI------AEKGPLSD 173
            |.. ...||:|:|.|.|.:||...|..:.||.::.  ||..:..|:|||||      ...|.|.:
Zfish   116 YNNLTNENDIALLHLSSAVTFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQE 180

  Fly   174 SLLFVQVTSISRGACRWMFYS-RLPETMICL-LHSKNSGACYGDSGGPATYGGKVVGLASLLLGG 236
            :::.|    :....|..:..| .:...|||. |.......|.||||||......:|.:.|.:...
Zfish   181 TMIPV----VPNDQCNALLGSGSVTNNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSW 241

  Fly   237 GCGRA---APDGYLRISKVRAWI 256
            |.|.|   :|..|.|:|:.::||
Zfish   242 GYGCADPYSPGVYTRVSQYQSWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 76/245 (31%)
Tryp_SPc 37..219 CDD:238113 64/204 (31%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 76/245 (31%)
Tryp_SPc 34..267 CDD:238113 77/246 (31%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.