DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and gzma

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:247 Identity:71/247 - (28%)
Similarity:103/247 - (41%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLS 101
            ||||...|:. ....:|:::...|.|||::|....|:||.||.:.....|     ::..|||.||
Zfish    28 IVGGKDVKKA-LSWMVSIQVNQNHKCGGILIHKEWVLTAAHCKEDSYSSV-----TVLIGSLSLS 86

  Fly   102 SDGVRIPVAEVIMHPNYATGGHN--------------DLAVLRLQ-----SPLTFDANIAAIQLA 147
            ....||.:             ||              |:.::||.     .|.........:|..
Zfish    87 KGSQRIAI-------------HNYEIPETFNKKTKKDDIMLIRLSKKVKAKPYKIPKKEKDVQPG 138

  Fly   148 TEDPPNCVAVDISGWGNIAEKG-PLSDSLLFVQVTSISRGACRWMFYSRLP---ETMICLLHS-K 207
            |:    ||   :.|||....|| ..||.|..::|..:.|..|. .:|:|.|   :.|:|..:: :
Zfish   139 TK----CV---VRGWGTTDYKGKQASDKLQMLEVLVVDRVQCN-RYYNRNPVITKDMLCAGNTQQ 195

  Fly   208 NSGACYGDSGGPATYGGKVVGLASLLLGG-GCG-RAAPDGYLRISKVR-AWI 256
            :.|.|.||||||......:||:.|   |. ||| ...|..|..:||.. .||
Zfish   196 HRGTCLGDSGGPLECEKNLVGVLS---GSHGCGDPKKPTVYTLLSKRHITWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/245 (28%)
Tryp_SPc 37..219 CDD:238113 56/205 (27%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587688
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.