DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and f7

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:252 Identity:73/252 - (28%)
Similarity:118/252 - (46%) Gaps:26/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPA 88
            |.:|.::.|   |||||....:|:.|.|..|.......|||.:|:...||||.||:|    .:|.
 Frog   202 VLKNVNKRA---RIVGGDMCPKGECPWQALLMYNEIFICGGTLIAPNWVITAAHCLK----PLPE 259

  Fly    89 DLWSIQAGSLLLSS-DGV--RIPVAEVIMHPNY---ATGGHNDLAVLRLQSPLTFDANIAAI--- 144
            :..::..|...:.: :|.  ...|:::|||.:|   .|...||:|:|:|.:|:.:...:..:   
 Frog   260 NKLTVVLGEHRIGTPEGTEQESKVSKIIMHEHYYGSKTNNDNDIALLKLTTPVNYTDYVVPLCLP 324

  Fly   145 --QLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSK 207
              |.|.::..:.....:||||.:.|.|...:.|..||:..:....|.......:.:.|.|..::.
 Frog   325 EKQFAVQELLSIRYSTVSGWGRLLESGATPELLQRVQLPRVKTQDCIRQTQMNISQNMFCAGYTD 389

  Fly   208 NS-GACYGDSGGPATYGGK----VVGLASLLLGGGCGRAAPDG-YLRISKVRAWIAE 258
            .| .:|.||||||.....|    :.|:.|  .|.||.:....| |.|:|:...||.|
 Frog   390 GSKDSCKGDSGGPHATQYKNTHFLTGIVS--WGLGCAKKEKYGVYTRVSRYTEWIKE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/236 (28%)
Tryp_SPc 37..219 CDD:238113 54/193 (28%)
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011
FXa_inhibition 153..189 CDD:373209
Tryp_SPc 212..445 CDD:238113 69/239 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.