DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and tmprss4a

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_005157547.1 Gene:tmprss4a / 777630 ZFINID:ZDB-GENE-061103-631 Length:458 Species:Danio rerio


Alignment Length:261 Identity:78/261 - (29%)
Similarity:126/261 - (48%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGH 77
            :|....::....:.:...|..:.|||||..|....:|.|:||:..|:|.|||.:::...|:||.|
Zfish   200 VCSTGTVISLSCSADCGLSRNQDRIVGGKDADIANWPWQVSLQYSGQHTCGGSLVTPNWVVTAAH 264

  Fly    78 CVKHGNDVVPADLWSIQAGSLLLSSDGVRIP---VAEVIMHPNYATGGHN-DLAVLRLQSPLTFD 138
            |. :|:.......|::.:|...|||    .|   |.|:|::.||.....: |:.:::||||:|..
Zfish   265 CF-NGDGRKALSRWTVVSGITYLSS----TPSSYVKEIIVNSNYKPAESDFDITMIKLQSPITLS 324

  Fly   139 ANIAAIQLATEDPPNCVAVD------ISGWGNIAEK-GPLSDSLLFVQVTSISRGACR--WMFYS 194
            .:...:.|    ||..:.:.      ::|||::||| |.||..|...|:..|....|.  .::.|
Zfish   325 ESRRPVCL----PPQNLGLKGGDGLVVTGWGHMAEKGGSLSSMLQKAQIQVIDSAQCSSPTVYGS 385

  Fly   195 RLPETMICL-LHSKNSGACYGDSGGPATYGGK---VVGLASLLLGGGCGRAA-PDGYLRISKVRA 254
            .:...|||. :.:....||.||||||..:...   :||:.|  .|.||.|.. |..|..:.::..
Zfish   386 SITPRMICAGVMAGGVDACQGDSGGPLVHLADRWVLVGVVS--WGVGCARPGFPGVYTNVDQMLD 448

  Fly   255 W 255
            |
Zfish   449 W 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 76/238 (32%)
Tryp_SPc 37..219 CDD:238113 63/195 (32%)
tmprss4aXP_005157547.1 LDLa 74..105 CDD:238060
SRCR_2 121..218 CDD:295335 1/17 (6%)
Tryp_SPc 223..449 CDD:214473 75/236 (32%)
Tryp_SPc 224..449 CDD:238113 74/235 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.