DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss36

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:255 Identity:84/255 - (32%)
Similarity:122/255 - (47%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EP--RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAG 96
            ||  |||||..|..|.:|.|:||...|.|.|||.:|:.:.|::|.||......:.|||..|:..|
Mouse    43 EPSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLG 107

  Fly    97 SLLLSSDG------VRIPVAEVIMHPNYAT---GGHNDLAVLRLQSPLTFDANIAAIQL--ATED 150
              :.|.||      :| .||.:::..||:|   |.  |||:|||.||.....::..:.|  |:..
Mouse   108 --VHSQDGPLEGAHMR-SVATILIPDNYSTVELGA--DLALLRLASPAKLGPSVRPVCLPRASHL 167

  Fly   151 PPNCVAVDISGWGNIAEKGPLSDS--LLFVQVTSISRGACRWMFYSR----------LPETMICL 203
            ..:..|...:|||::.|..||...  |..|::..:...||:.: |||          ||..:...
Mouse   168 FAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCL-YSRPGPFNLTFQLLPGMLCAG 231

  Fly   204 LHSKNSGACYGDSGGPATY--GGK--VVGLASLLLGGGCGRA-APDGYLRISKVRAWIAE 258
            ..:.....|.||||||...  ||:  :.|:.|  .|.||||. .|..:..::...:||.|
Mouse   232 YPAGRRDTCQGDSGGPLVCEDGGRWFLAGITS--FGFGCGRRNRPGVFTAVAPYESWIRE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/247 (32%)
Tryp_SPc 37..219 CDD:238113 66/204 (32%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 81/250 (32%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.