DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:242 Identity:66/242 - (27%)
Similarity:112/242 - (46%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK---------HGNDVVPAD 89
            :.:||||....:...|:|:||.....|.|||.:||...|::|.||.|         |..||    
Mouse    21 DDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWVLSAAHCYKRRLQVRLGEHNIDV---- 81

  Fly    90 LWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQLATEDPPN 153
               ::.|...:.::       ::|.||:|.... .||:.:::|:||...::.::.:.|    |.:
Mouse    82 ---LEGGEQFIDAE-------KIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSL----PRS 132

  Fly   154 CVAVD----ISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWMFYSRLPETMICL-LHSKNSGAC 212
            |.:.:    :|||||....|....:|| .::...:|..:|:..:..::...|.|| .......:|
Mouse   133 CASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSC 197

  Fly   213 YGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAE 258
            .||||||....|::.|:.|  .|..|. |..|..|.::....:||.|
Mouse   198 DGDSGGPVVCNGEIQGIVS--WGSVCAMRGKPGVYTKVCNYLSWIQE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/236 (27%)
Tryp_SPc 37..219 CDD:238113 53/197 (27%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 63/236 (27%)
Tryp_SPc 24..243 CDD:238113 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.