DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss44

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:247 Identity:78/247 - (31%)
Similarity:118/247 - (47%) Gaps:37/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVV----PADLWSIQAG 96
            |||||..|...::|.|:||::..:|.|||.:||...||||.|||....|..    .|||||.:. 
Mouse   111 RIVGGRPAPARKWPWQVSLQVHKQHICGGSLISKWWVITAAHCVYGHLDYAVFMGDADLWSKRP- 174

  Fly    97 SLLLSSDGVRIPVAEVIMHPNYA---TGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD 158
                    |||||.::|:|.:::   |..| |:|::.|..|:.:..||..:.:    |.....|.
Mouse   175 --------VRIPVQDIIVHQDFSMMRTVVH-DIALVLLAFPVNYSVNIQPVCI----PEKSFLVQ 226

  Fly   159 ------ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWM-------FYSRLPETMICLLHSKNSG 210
                  ::|||.:.|:|..|..|..:::..|....|..:       .::.:.|..:|..:.|...
Mouse   227 PGTLCWVTGWGKVLEQGRSSRILQEIELNIIRHEKCNQILKDIMGNIFTLVQEGGVCGYNEKGGD 291

  Fly   211 ACYGDSGGP--ATYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWIAEK 259
            ||.||||||  ..:....|.:..:..|.||||.. |..|..:|..|.||.::
Mouse   292 ACQGDSGGPLVCEFNKTWVQVGIVSWGLGCGRIGYPGVYTEVSYYRDWIIKE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 76/242 (31%)
Tryp_SPc 37..219 CDD:238113 63/201 (31%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 76/242 (31%)
Tryp_SPc 112..340 CDD:238113 75/241 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.