DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss22

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:278 Identity:83/278 - (29%)
Similarity:129/278 - (46%) Gaps:40/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVI------LGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVI 66
            :||:||.....|      :..|..:.|..:    |||||..:...|:|..:|:...|.|:|.|.:
Mouse    77 ILLVLLTSTAPISAATIRVSPDCGKPQQLN----RIVGGEDSMDAQWPWIVSILKNGSHHCAGSL 137

  Fly    67 ISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVR---IPVAEVIMHPNYA--TGGHNDL 126
            ::...|:||.||.|...|  ...|:|:..|:..|.|.|.|   :.:|.|:.||.|:  .|.|.|:
Mouse   138 LTNRWVVTAAHCFKSNMD--KPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADI 200

  Fly   127 AVLRLQSPLTFDANIAAIQLATED---PP--NCVAVDISGWGNIAEKGPL--SDSLLFVQVTSIS 184
            |::||:..:.|...|..|.|....   ||  :|.   |:|||:|.:..||  ..:|..::|..|.
Mouse   201 ALVRLEHSIQFSERILPICLPDSSVRLPPKTDCW---IAGWGSIQDGVPLPHPQTLQKLKVPIID 262

  Fly   185 RGACRWMFY-----SRLPETMICLLHSKNS-GACYGDSGGP----ATYGGKVVGLASLLLGGGCG 239
            ...|:.:::     ..:.|.|:|..:.:.. .||.||||||    ......:.|:.|  .|.||.
Mouse   263 SELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIIS--WGEGCA 325

  Fly   240 -RAAPDGYLRISKVRAWI 256
             |..|..|..:...|:|:
Mouse   326 ERNRPGVYTSLLAHRSWV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/242 (31%)
Tryp_SPc 37..219 CDD:238113 63/199 (32%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.