DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss32

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_081496.2 Gene:Prss32 / 69814 MGIID:1917064 Length:334 Species:Mus musculus


Alignment Length:290 Identity:79/290 - (27%)
Similarity:126/290 - (43%) Gaps:64/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VILGQDVAQNQSES-------------------AIEPRIVGGIKAKQGQFPHQISLRLRGEHYCG 63
            |:||.:|....|:|                   ....|||.|..|:.|::|.|:|:|..|.|.||
Mouse    16 VLLGSEVLPTDSDSPSTTTGRRSIDLDSVCGRPRTSGRIVSGQDAQLGRWPWQVSVRENGAHVCG 80

  Fly    64 GVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIP----------VAEVIMHPNY 118
            |.:|:...|:||.||...|..:   .::::..|:  :||    .|          ||:.|.||:|
Mouse    81 GSLIAEDWVLTAAHCFNQGQSL---SIYTVLLGT--ISS----YPEDNEPKELRAVAQFIKHPSY 136

  Fly   119 ATGGHN--DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD------ISGWGNIAEKGPLSD-- 173
            :...|:  |:|:::|.||::|:..:..:.|.....|    :|      ::|||:|....||..  
Mouse   137 SADEHSSGDIALVQLASPISFNDYMLPVCLPKPGDP----LDPGTMCWVTGWGHIGTNQPLPPPF 197

  Fly   174 SLLFVQVTSISRGACRWMFY-SRLP-------ETMICL-LHSKNSGACYGDSGGPATYGGKVVGL 229
            :|..:||..|....|...:. :.:|       |.|:|. .......||.||||||.......|.:
Mouse   198 TLQELQVPLIDAETCNTYYQENSIPGTEPVILEGMLCAGFQEGKKDACNGDSGGPLVCDINDVWI 262

  Fly   230 ASLLLGGGCGRA---APDGYLRISKVRAWI 256
            .:.::..|...|   .|..|..:|...:||
Mouse   263 QAGVVSWGSDCALFKRPGVYTNVSVYISWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/251 (28%)
Tryp_SPc 37..219 CDD:238113 62/210 (30%)
Prss32NP_081496.2 Tryp_SPc 53..292 CDD:214473 71/251 (28%)
Tryp_SPc 54..295 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.