DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk10

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:276 Identity:74/276 - (26%)
Similarity:113/276 - (40%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            ||....|||.|           |.:...:|   ..|.:.::...|.|:||....:..|.||::..
Mouse    29 LWAAQALLLPG-----------NATRVDLE---ASGAQCERDYHPWQVSLFHNLQFQCAGVLVDQ 79

  Fly    70 THVITAGHCVKH-------GNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGG---- 122
            ..|:||.||.::       |:|.:           ||...:.:| ..:..:.||.| |..|    
Mouse    80 NWVLTAAHCWRNKPLRARVGDDHL-----------LLFQKEQLR-STSSPVFHPKYQACSGPILP 132

  Fly   123 ----HNDLAVLRLQSPLTFDANIAAIQL---ATEDPPNCVAVDISGWGNIAEKG-PLSDSLLFVQ 179
                .:||.:|:|.||:...:|:..:||   .::....|   .:||||..|.:. ..:.||...:
Mouse   133 HRSDEHDLMMLKLSSPVMLTSNVHPVQLPFRCSQPGQEC---QVSGWGTSASRRVKYNRSLSCSK 194

  Fly   180 VTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG---CGRA 241
            ||.:|:..|...:...:..:|||.....|..:|..|||||......:.|    :|..|   ||.|
Mouse   195 VTLLSQKQCETFYPGVITNSMICAEADGNQDSCQSDSGGPLVCDDTLHG----VLSWGIYPCGAA 255

  Fly   242 A-PDGYLRISKVRAWI 256
            . |..|..|.|...||
Mouse   256 QHPSVYSEICKYTPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 64/243 (26%)
Tryp_SPc 37..219 CDD:238113 52/201 (26%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 64/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.