DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Klk12

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:263 Identity:78/263 - (29%)
Similarity:113/263 - (42%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHY-CGGVIISATHV 72
            :|||||.|.:           ..|...:|..|::..:...|.|:.| ..|::. ||||::....|
Mouse     5 ILLLLCAVGL-----------SQADREKIYNGVECVKNSQPWQVGL-FHGKYLRCGGVLVDRKWV 57

  Fly    73 ITAGHC-----VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHN---DLAVL 129
            :||.||     |:.|...:....|:.|......|           |.||:|.....|   ||.:|
Mouse    58 LTAAHCRDKYVVRLGEHSLTKLDWTEQLRHTTFS-----------ITHPSYQGAYQNHEHDLRLL 111

  Fly   130 RLQSPLTFDANIAAIQLATEDPPNCVAV----DISGWGNIAEK-GPLSDSLLFVQVTSISRGACR 189
            ||..|:.....:..:.|    |.:||..    .:||||...:. .|..|.|..:.::::|...||
Mouse   112 RLNRPIHLTRAVRPVAL----PSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCR 172

  Fly   190 WMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVR 253
            .:|..|:.|.|:|........||.||||||...||.:.||.|....|.|| :..|..|.::.|..
Mouse   173 AVFPGRVTENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYT 237

  Fly   254 AWI 256
            .||
Mouse   238 DWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/234 (29%)
Tryp_SPc 37..219 CDD:238113 56/195 (29%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.