DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss11a

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038948511.1 Gene:Tmprss11a / 686581 RGDID:1596322 Length:387 Species:Rattus norvegicus


Alignment Length:268 Identity:77/268 - (28%)
Similarity:119/268 - (44%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHC 78
            ||.:.|           ..|..|||.|..|.:|.:|.|:||:....|.|||.:|....|:||.||
  Rat   144 CGKRAI-----------PLIANRIVSGNPAAKGAWPWQVSLQRNNIHQCGGTLIGNMWVVTAAHC 197

  Fly    79 VKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGH-NDLAVLRLQSPLTFDANIA 142
            .:  .:..|.. |::..|: .::...::..|..:|||..|..... :|:|:::....:||...:.
  Rat   198 FR--TNANPRQ-WTLSFGT-TINPPLMKREVRRIIMHEKYRPPARDHDIALVQFSPRVTFSDEVR 258

  Fly   143 AIQL---ATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGAC--RWMFYSRLPETMIC 202
            .|.|   :...|||. .|.|:|:|.:...|...:.|...:|..||...|  |.::.:.:...|.|
  Rat   259 RICLPEPSASFPPNS-TVYITGFGALYYGGESQNELREARVQIISNDVCKQRHVYGNEIKRGMFC 322

  Fly   203 LLHSKNSG-------ACYGDSGGPATYGGK-----VVGLASLLLGGGCG-RAAPDGYLRISKVRA 254
                  :|       ||.||||||......     ::|:.|  .|..|| :..|..|.:::..|.
  Rat   323 ------AGFLEGIYDACRGDSGGPLVVRDDKDTWYLIGIVS--WGDNCGQKNKPGVYTQVTYYRR 379

  Fly   255 WIAEKAGL 262
            |||.|.||
  Rat   380 WIASKTGL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/238 (28%)
Tryp_SPc 37..219 CDD:238113 56/194 (29%)
Tmprss11aXP_038948511.1 SEA 35..133 CDD:396113
Tryp_SPc 156..384 CDD:238113 69/240 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.