DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC683849

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:268 Identity:76/268 - (28%)
Similarity:121/268 - (45%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHV 72
            :|:|.|.|..|....|         .:.:||||...::...|:|:||. .|.|:|||.:|:...|
  Rat     4 LLILALVGTAVAFPVD---------DDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWV 58

  Fly    73 ITAGHCVK---------HGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLA 127
            ::|.||.|         |..:|:..:...:.|              |::|.|||:.... :||:.
  Rat    59 VSAAHCYKSRIQVRLGEHNINVLEGNEQFVNA--------------AKIIKHPNFDRKTLNNDIM 109

  Fly   128 VLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWM 191
            :::|.||:..:|.:|.:.|.:...|......||||||....|.....|| .:....:.:..|...
  Rat   110 LIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEAS 174

  Fly   192 FYSRLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDG---YLRIS 250
            :..::.:.|:|   |...|:|  |.||||||....|::.|:.|  .|.||  |.||.   |.::.
  Rat   175 YPGKITDNMVCAGFLEGGKDS--CQGDSGGPVVCNGELQGIVS--WGYGC--ALPDNPGVYTKVC 233

  Fly   251 KVRAWIAE 258
            ....||.:
  Rat   234 NYVDWIED 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/236 (29%)
Tryp_SPc 37..219 CDD:238113 56/195 (29%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 68/236 (29%)
Tryp_SPc 24..242 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.