DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss55

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:268 Identity:75/268 - (27%)
Similarity:133/268 - (49%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVLLLLL--------CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCG 63
            ::|||::        |||:.:....:..:        ||:||.:|:.|:||.|:|::....|:||
  Rat     5 SILLLVVHTLEANVECGVRPLYDSRIGHS--------RIIGGQEAEVGEFPWQVSIQENDHHFCG 61

  Fly    64 GVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLA 127
            |.|:|...::|..||. :..::.|.:| :::.|:..|::..:.:.|..:|.|.::.... .||:|
  Rat    62 GSILSEWWILTVAHCF-YSQELSPTEL-TVRVGTNDLTTSPMELQVTNIIRHKDFKRHSMDNDIA 124

  Fly   128 VLRLQSPLTFDANIAAIQLATE-DPPNCVAVDISGWG--NIAEKGPLSDSLLFVQVTSISRGACR 189
            :|.|.:||||:.....|.:..: .||:.....::|||  |.|:|..::..|:.|.:.......|.
  Rat   125 LLLLANPLTFNEQTVPICMPLQPTPPSWQECWVAGWGTTNSADKESMNMDLMKVPMRITDWKECL 189

  Fly   190 WMFYSRLPETMICLLHSKNS-GACYGDSGGPATYG----GKVVGLASLLLGGGCG-RAAPDGYLR 248
            .:|.| |...|:|..:...| .||.||||||....    |:...:..:..|..|| :.:|..|..
  Rat   190 QLFPS-LTTNMLCASYGNESFDACQGDSGGPLVCNQESDGRWYQVGIISWGKSCGQKGSPGIYTV 253

  Fly   249 ISKVRAWI 256
            ::....||
  Rat   254 LANYILWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/229 (29%)
Tryp_SPc 37..219 CDD:238113 58/186 (31%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.