DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss47

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038952282.1 Gene:Prss47 / 680378 RGDID:1592951 Length:398 Species:Rattus norvegicus


Alignment Length:331 Identity:84/331 - (25%)
Similarity:135/331 - (40%) Gaps:83/331 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQV--ILGQDV-----------AQNQSESAIEP--------------------- 35
            ||.:||||....:.  :|...:           .:.|.:...||                     
  Rat    17 LWPLLLLLSLSPKAGPVLKSSIPSPSKVPEIAPGRPQPQQGWEPSASRNQDPVTRPVCGKPKMVG 81

  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            ::.||.....||:|.|.||..||.|.||.|:|.:..:::..||.::.:. .|.| :.:..|:..|
  Rat    82 KVFGGQDTLAGQWPWQASLLYRGLHLCGAVLIDSHWLVSTAHCFRNKSQ-APED-YEVLLGNNQL 144

  Fly   101 ---SSDGVRIPVAEVIMHPNY----ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDP--PNCVA 156
               :....:|||..:|.||::    :.|  :|:|:|:|:.|:.|.:.:....|.::|.  .|..:
  Rat   145 YQKTKHTQKIPVNHIINHPDFEKFHSFG--SDIAMLQLRLPVNFTSYVVPACLPSKDTQLSNHTS 207

  Fly   157 VDISGWGNIAE--KGPLS-------------------DSLLFVQVTSISRGACRWMFYSRL---- 196
            ..|:|||.::|  ||..|                   .||...:|..|....|..::..||    
  Rat   208 CWITGWGMLSEDSKGKRSWRGSKGREKRKIRAKLLPPFSLQEGEVGIIENEFCNALYGQRLGQSR 272

  Fly   197 ---PETMICLLH-SKNSGACYGDSGGPAT----YGGKVVGLASLLLGGGCGRAA-PDGYLRISKV 252
               .|.|:|... |.....|.||||||..    ....:|||||  .|..|..:. |..:.|::..
  Rat   273 NYVHEEMLCAGGLSTGKSICRGDSGGPLVCYHISAWVLVGLAS--WGLDCRPSIYPSVFTRVTYF 335

  Fly   253 RAWIAE 258
            ..||::
  Rat   336 TDWISQ 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/262 (27%)
Tryp_SPc 37..219 CDD:238113 61/219 (28%)
Prss47XP_038952282.1 Tryp_SPc 83..342 CDD:238113 74/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.