DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and prss1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:269 Identity:76/269 - (28%)
Similarity:119/269 - (44%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVI--LGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATH 71
            :||.|..|...  ||.|          :.:||||.:..:...|:|:||. .|.|:|||.:||...
Zfish     5 ILLALFAVAYAAPLGDD----------DDKIVGGYECTKNGVPYQVSLN-SGYHFCGGSLISNLW 58

  Fly    72 VITAGHCVK---------HGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDL 126
            |::|.||.|         |..||.       :.....::|:       :||.||:|.:.. .||:
Zfish    59 VVSAAHCYKSRVQVRLGEHNIDVT-------EGTEQFINSE-------KVIRHPSYNSNTLDNDV 109

  Fly   127 AVLRLQSPLTFDANIAAIQLATEDPPNCVAVD----ISGWGNIAEKGPLSDS-LLFVQVTSISRG 186
            .:::|.|....::.:..:.|    |.:|.:..    ||||||::..|....| |:.:....:|..
Zfish   110 MLIKLSSSAQINSYVKTVSL----PSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDS 170

  Fly   187 ACRWMFYSRLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYL 247
            .||..:..::...|.|   :...|:|  |.||||||.....::.|:.|  .|.||. |..|..|.
Zfish   171 TCRNAYPGQISSNMFCAGFMEGGKDS--CQGDSGGPVVCNNQLQGIVS--WGYGCAQRNKPGVYA 231

  Fly   248 RISKVRAWI 256
            ::.....||
Zfish   232 KVCNFTTWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/238 (28%)
Tryp_SPc 37..219 CDD:238113 57/199 (29%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 67/238 (28%)
Tryp_SPc 25..243 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.