DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and TPSB2

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:270 Identity:76/270 - (28%)
Similarity:128/270 - (47%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIE-PRIVGGIKAKQGQFPHQISLRLRGE---HYCGGVIIS 68
            :|.|||..:.|:..:..|......|:: ..||||.:|.:.::|.|:|||:|..   |:|||.:|.
Human     1 MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIH 65

  Fly    69 ATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQ 132
            ...|:||.|||  |.||.......:|.....|......:||:.:|:||.:.|.... |:|:|.|:
Human    66 PQWVLTAAHCV--GPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELE 128

  Fly   133 SPLTFDANIAAIQL--ATEDPPNCVAVDISGWGNI--AEKGPLSDSLLFVQVTSISRGACRWMFY 193
            .|:...:::..:.|  |:|..|..:...::|||::  .|:.|....|..|:|..:....|...::
Human   129 EPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYH 193

  Fly   194 ---------SRLPETMICLLHSKNSGACYGDSGGP--ATYGGKVVGLASLLLGGGCGRA-APDGY 246
                     ..:.:.|:|..:::.. :|.||||||  ....|..:....:..|.||.:. .|..|
Human   194 LGAYTGDDVRIVRDDMLCAGNTRRD-SCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIY 257

  Fly   247 LRISKVRAWI 256
            .|::....||
Human   258 TRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/239 (28%)
Tryp_SPc 37..219 CDD:238113 58/198 (29%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 69/240 (29%)
Tryp_SPc 31..267 CDD:214473 67/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.