DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CELA2A

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:256 Identity:76/256 - (29%)
Similarity:119/256 - (46%) Gaps:56/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGE----HYCGGVIISATHVITAGHCV-----------KHGNDV 85
            |:|||.:|:...:|.|:||:....    |.|||.:|:.:.|:||.||:           :|    
Human    28 RVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGGSLIANSWVLTAAHCISSSRTYRVGLGRH---- 88

  Fly    86 VPADLWSIQAGSLLLSSDGVRIPVAEVIMH----PNYATGGHNDLAVLRLQSPLTFDANIAAIQL 146
               :|:..::|||.:|       |:::::|    .|..:.| ||:|:|:|.:|::....   |||
Human    89 ---NLYVAESGSLAVS-------VSKIVVHKDWNSNQISKG-NDIALLKLANPVSLTDK---IQL 139

  Fly   147 ATEDP-----PNCVAVDISGWGNIAEKGPLSD-----SLLFVQVTSISRGACRWMFYSRLPETMI 201
            |...|     ||.....::|||.:...|.:.|     .||.|...:.|..|  | :.|.:..:||
Human   140 ACLPPAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSA--W-WGSSVKTSMI 201

  Fly   202 CLLHSKNSGACYGDSGGP----ATYG-GKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWI 256
            |........:|.||||||    |:.| .:|.|:.|.....||. ...|..:.|:|....||
Human   202 CAGGDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 74/254 (29%)
Tryp_SPc 37..219 CDD:238113 61/210 (29%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.