DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and c1s

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:271 Identity:71/271 - (26%)
Similarity:110/271 - (40%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGH 77
            :|||          :||:.:  .||.||.:||.||||..|  :.......||.:||...|:||.|
 Frog   425 VCGV----------HQSDKS--GRIFGGTRAKPGQFPWMI--QFTDIELGGGSLISDRWVLTAAH 475

  Fly    78 CVKHGNDVVPADLWSIQAGSLL-------LSSDGVRIPVAEVIMHPNYA----TGGH----NDLA 127
                   ||...::....|.::       |.|...|:...::|:||.|.    |.|.    ||:|
 Frog   476 -------VVNKKIFPTMFGGVMKFFPNTNLQSQEKRLQAKKIIIHPLYQDNEDTEGQSNFDNDIA 533

  Fly   128 VLRLQSPLTFDANIAAIQLATED--PPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRW 190
            :::|...:...:.|:.|.|....  |.......|:|||. .||...:.:|.|..::..|...|:.
 Frog   534 LVQLTKKVKLGSCISPICLPRRGLAPVVNEVATIAGWGK-TEKRESAVNLQFASISLSSMDKCKK 597

  Fly   191 MFYSR--LPETMICLLHSKNSGACYGDSGGPATY----GGKVVGLASLLLGG--GCGRAAPDGYL 247
            ....:  ....|:|........:|.||||||..:    ....:.:|.::..|  .||....  |.
 Frog   598 ATGGKGYFTPNMLCAGSDVGKDSCNGDSGGPLMFTDPQDSSKMYMAGIVSWGPRDCGTYGL--YT 660

  Fly   248 RISKVRAWIAE 258
            ::.....||.|
 Frog   661 KVDNYLDWIEE 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/244 (26%)
Tryp_SPc 37..219 CDD:238113 55/200 (28%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 5/22 (23%)
Tryp_SPc 436..669 CDD:214473 63/244 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.