DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG17242

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:274 Identity:68/274 - (24%)
Similarity:114/274 - (41%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLCGVQVILG-QDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVIT 74
            :||.|:.:::. ..:|.:.....||            |.|.|.|:::..:|:|||||.|...::|
  Fly     1 MLLKGILLLVSIAQIAADFKSIGIE------------QAPWQASVQINDKHHCGGVIYSEDIILT 53

  Fly    75 AGHCVKHGN-DVVPADLWSIQ--AGSLLLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLT 136
            ...||:... :.:...:.|.|  ||..:|..:.:|:.|  :.:.|       :|:|:|:|:|||.
  Fly    54 IAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQV--LGLRP-------SDVAILQLRSPLY 109

  Fly   137 FDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMI 201
            .|..|.||.|||..........:||||.::...|.|:.||.|.|              ::.:.::
  Fly   110 LDGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDV--------------KIQDQLM 160

  Fly   202 CLLHSKNSG------------------ACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPD---- 244
            |..:....|                  ||.|..|||.....::.|:.|       .::|.|    
  Fly   161 CATNLALKGRLMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILS-------WQSACDVLNK 218

  Fly   245 --GYLRISKVRAWI 256
              .|..|:..:.||
  Fly   219 SSVYANIAMFKVWI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 60/246 (24%)
Tryp_SPc 37..219 CDD:238113 52/202 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 64/251 (25%)
Tryp_SPc 24..232 CDD:214473 62/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.