DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG17234

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:236 Identity:78/236 - (33%)
Similarity:117/236 - (49%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV--KHGNDVVPADLWSIQAG 96
            |.||:||......|.|.|:||:..|:|.|||.|.|...::||.||.  :.||.:.... :.::||
  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQG-YQVRAG 87

  Fly    97 SLLLSSDGVRIPVAEVIMHPNYATG-GHNDLAVLRLQSPLTFDANIAAIQLATEDP-PNCVAVDI 159
            |.|..|:|..:.||.:|:|..||.. ..||:|::||.:||.|.:.:..|.||..:| |..:|: :
  Fly    88 SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL-V 151

  Fly   160 SGWGNIAEKGPLSDSL---------LFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGD 215
            ||||   ....|:||.         |.:.:.||        |..||.:..:....:....||:||
  Fly   152 SGWG---VSYILNDSTNLYPTHLQGLALHIKSI--------FSCRLFDPSLLCAGTYGRTACHGD 205

  Fly   216 SGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ||||.....::||:.|   .|..|..:...::.:...|.||
  Fly   206 SGGPLVVNKQLVGVVS---WGRKGCVSSAFFVSVPYFREWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/232 (32%)
Tryp_SPc 37..219 CDD:238113 66/194 (34%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/232 (32%)
Tryp_SPc 27..243 CDD:238113 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.