DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG17239

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:229 Identity:75/229 - (32%)
Similarity:108/229 - (47%) Gaps:8/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSI 93
            |.:.|..|||||........|.|.|:...|..:||..|.|...||||.||:....    .:..|:
  Fly    16 SSNWIPERIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRE----TEFLSV 76

  Fly    94 QAGSLLLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD 158
            :.||......|..:.|:.|::|..|.....||:||:||||.|...:.::.|.||...|.:.....
  Fly    77 RVGSSFTFFGGQVVRVSSVLLHEEYDQSWSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPAT 141

  Fly   159 ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYG 223
            :||||.|..|.....|:|...|..:.:..||..:..::.:.|||.. :....||.||||||...|
  Fly   142 VSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKDMICAA-APGKDACSGDSGGPLVSG 205

  Fly   224 GKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWI 256
            .|:||:.|  .|..|.... |..|..:::::.||
  Fly   206 NKLVGIVS--FGKECAHPEYPGVYANVAELKPWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/220 (32%)
Tryp_SPc 37..219 CDD:238113 59/181 (33%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 71/220 (32%)
Tryp_SPc 24..237 CDD:238113 70/219 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.