DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG18735

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:275 Identity:84/275 - (30%)
Similarity:131/275 - (47%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VQVILGQDVAQNQSESA-------------IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVII 67
            :|.|||.:|....|..|             ...|||||.:.:..::|..|.|...|..|||..::
  Fly    49 IQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLV 113

  Fly    68 SATHVITAGHCVK---HGNDVVPADLWSIQAGSLLLSSDGVRI---PVAEVIMHPNYATGG-HND 125
            :..:.:||.|||.   |       .|.:::..........|:|   .|:.|::||.|:|.. .:|
  Fly   114 NDQYALTAAHCVNGFYH-------RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSD 171

  Fly   126 LAVLRLQSP--LTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGAC 188
            :|::|...|  |..|.:...:...:|:.....|| ::|||.::|.||:||:|..|:|..:|:..|
  Fly   172 IALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAV-VTGWGALSEGGPISDTLQEVEVPILSQEEC 235

  Fly   189 RWMFY--SRLPETMICLLHSKNSG--ACYGDSGGPATYGG-----KVVGLASLLLGGGCGRA-AP 243
            |...|  |::.:.|||..:.:..|  :|.||||||....|     ::.|:.|  .|.||.:. ||
  Fly   236 RNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVS--WGEGCAKPNAP 298

  Fly   244 DGYLRISKVRAWIAE 258
            ..|.|:.....||||
  Fly   299 GVYTRVGSFNDWIAE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/238 (31%)
Tryp_SPc 37..219 CDD:238113 60/194 (31%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/238 (31%)
Tryp_SPc 83..314 CDD:238113 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.