powered by:
Protein Alignment CG32523 and CG34457
DIOPT Version :9
Sequence 1: | NP_728401.1 |
Gene: | CG32523 / 318071 |
FlyBaseID: | FBgn0052523 |
Length: | 262 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097339.1 |
Gene: | CG34457 / 5740661 |
FlyBaseID: | FBgn0085486 |
Length: | 308 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 13/71 - (18%) |
Similarity: | 26/71 - (36%) |
Gaps: | 13/71 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 PPNCVAVDISGW-----------GNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRL--PETMIC 202
|.|.:.:..:.| .:..|..|.:..|:.|..|:....|...:....| ||.::.
Fly 209 PDNDIPIAYTNWFCRHVNPKQRFESEGEDIPSNSPLVIVHATTNRNLAAENVLIQTLFGPEFLVS 273
Fly 203 LLHSKN 208
:.:.:|
Fly 274 VQNYRN 279
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E33208_3BBP0 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.