DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss21

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:249 Identity:85/249 - (34%)
Similarity:120/249 - (48%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            |..|||||..|:.|::|.|.|||:.|.|.||..:::...|:||.||.:..||  |.| |::|.|.
Mouse    51 IPSRIVGGDDAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDND--PFD-WTVQFGE 112

  Fly    98 LL-------LSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLAT-----ED 150
            |.       |.:...|..:.::.:.|.|:....||:|:|:|.||:|::..|..|.|..     |:
Mouse   113 LTSRPSLWNLQAYSNRYQIEDIFLSPKYSEQYPNDIALLKLSSPVTYNNFIQPICLLNSTYKFEN 177

  Fly   151 PPNCVAVDISGWGNIAEKG--PLSDSLLFVQVTSISRGACRWM-----FYSRLPETMICL-LHSK 207
            ..:|.   ::|||.|.|..  |..::|..|||..|:...|..|     |.:.:...|:|. ....
Mouse   178 RTDCW---VTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTNIWGDMVCAGTPEG 239

  Fly   208 NSGACYGDSGGPATYGGKV----VGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            ...||:||||||.......    ||:.|  .|.||||. .|..|..||....||
Mouse   240 GKDACFGDSGGPLACDQDTVWYQVGVVS--WGIGCGRPNRPGVYTNISHHYNWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 82/244 (34%)
Tryp_SPc 37..219 CDD:238113 67/201 (33%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 82/244 (34%)
Tryp_SPc 55..294 CDD:238113 83/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.