DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and tmprss5

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:266 Identity:79/266 - (29%)
Similarity:120/266 - (45%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHC 78
            ||.:..|              |||:||::|..|::|.|:||.....|.|||.||:...::||.||
Zfish   303 CGTRAKL--------------PRIIGGVEAALGRWPWQVSLYYNNRHICGGSIITNQWIVTAAHC 353

  Fly    79 VKHGNDVVPADLWSIQAGSLLLSSDGVRI------PVAEVIMHPNYATGGH-NDLAVLRLQSPLT 136
            | |...:.....|.:.||  :::|:..::      .|..:|.:.||....| ||:|:::|::||.
Zfish   354 V-HNYRLPQVPSWVVYAG--IITSNLAKLAQYQGFAVERIIYNKNYNHRTHDNDIALVKLKTPLN 415

  Fly   137 FDANIAAIQLA--TEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTS------ISRGACR--WM 191
            |...|..:.|.  ..|.|......|||||...     .|.:|..:|..      ||...|.  .|
Zfish   416 FSDTIRPVCLPQYDHDLPGGTQCWISGWGYTQ-----PDDVLIPEVLKEAPVPLISTKKCNSSCM 475

  Fly   192 FYSRLPETMICLLHSKNS-GACYGDSGGPATYGG----KVVGLASLLLGGGCGRA-APDGYLRIS 250
            :...:...|:|..:|:.. .||.||||||.....    ::||:.|  .|.||... .|..|.:::
Zfish   476 YNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWRLVGVVS--WGTGCAEPNHPGVYSKVA 538

  Fly   251 KVRAWI 256
            :...||
Zfish   539 EFLGWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/242 (30%)
Tryp_SPc 37..219 CDD:238113 62/199 (31%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 2/2 (100%)
Tryp_SPc 311..544 CDD:214473 73/242 (30%)
Tryp_SPc 312..547 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.