DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and si:dkey-21e2.15

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003201076.1 Gene:si:dkey-21e2.15 / 567711 ZFINID:ZDB-GENE-050208-780 Length:251 Species:Danio rerio


Alignment Length:233 Identity:71/233 - (30%)
Similarity:107/233 - (45%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLS 101
            |..|.:||....|:.:||:...::.|||.:|:...|:||.||.|.|      |:.::..|:..||
Zfish    26 IEDGTEAKPHSRPYMVSLQKNSKNSCGGSLITEEFVLTAAHCWKKG------DVITVVVGAHDLS 84

  Fly   102 SDGV--RIPVAEVIMHPNYATGGH-NDLAVLRLQSPLTFDANIAAIQLAT--EDPPNCVAVDISG 161
            .:..  ...|...|.||.::...: ||:.:|:|...:|...|:..|.|..  ||........::|
Zfish    85 ENETYDSFEVTSYIPHPEFSWQNYENDIMLLKLNKKVTLSNNVGLISLPKNGEDVKEDAVCSVAG 149

  Fly   162 WGNIAEKGPLSDSLLFVQVTSISRGAC--RWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGG 224
            ||.:...||..|.|:..:...:|...|  ||....: |..|.|:.  .:.|.|.||||||...|.
Zfish   150 WGRLWLNGPRPDRLMEAETVIVSGEECKRRWESLFK-PSKMFCVY--GHGGTCKGDSGGPLVCGE 211

  Fly   225 KVVGLASLLLGGGC-GRAAPDGYLRISKVRAWIAEKAG 261
            ..||:.|......| .|..|:.|.:||...:||.:..|
Zfish   212 HAVGVTSFSDRYSCNSRLLPNMYTKISAYLSWIQKITG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/226 (30%)
Tryp_SPc 37..219 CDD:238113 56/188 (30%)
si:dkey-21e2.15XP_003201076.1 Tryp_SPc 26..247 CDD:238113 70/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.