DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP011918

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001689276.1 Gene:AgaP_AGAP011918 / 5667954 VectorBaseID:AGAP011918 Length:259 Species:Anopheles gambiae


Alignment Length:264 Identity:87/264 - (32%)
Similarity:134/264 - (50%) Gaps:16/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISL-RLRGEHYCGGVIISA 69
            | |..::||...|..|:|.|...::  .|.|||.|:.|..||||:|:|| ....:|:|||.||..
Mosquito     4 W-VAFVVLCVASVACGEDAALRTAD--WEGRIVNGLNAVSGQFPYQVSLTSATYQHFCGGAIIGN 65

  Fly    70 THVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQS 133
            ..::||.||:....   ||::.:: .|:|..:..|....|.:.|:|||: .....||:|::|.:.
Mosquito    66 HWILTAAHCLTGRK---PAEVIAV-VGALTSARGGYNYDVEQFILHPNFNEWTQQNDIALVRTKW 126

  Fly   134 PLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPL-SDSLLFVQVTSISRGACRWMFYS--- 194
            .::|:..:..:::|....|...||..||||......|. :|.|.:|.:.:||...|...|..   
Mosquito   127 SISFNTAVFPVKMARTYTPANRAVLASGWGLTTLSVPKPADRLQYVALRTISNEDCSERFRKLQN 191

  Fly   195 -RLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAE 258
             .:..:::|.......|.|.||||||....|::||:.|  .|..|....||.|:|:|..||||..
Mosquito   192 RAITPSILCTFSRNEQGTCMGDSGGPLVEDGELVGIVS--WGIPCAVGYPDVYVRVSSFRAWIGA 254

  Fly   259 KAGL 262
            ..|:
Mosquito   255 VTGV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/226 (33%)
Tryp_SPc 37..219 CDD:238113 59/188 (31%)
AgaP_AGAP011918XP_001689276.1 Tryp_SPc 31..252 CDD:214473 75/226 (33%)
Tryp_SPc 32..252 CDD:238113 74/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.