DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP001249

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001689375.2 Gene:AgaP_AGAP001249 / 5667667 VectorBaseID:AGAP001249 Length:267 Species:Anopheles gambiae


Alignment Length:273 Identity:86/273 - (31%)
Similarity:130/273 - (47%) Gaps:28/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLL-----LCGVQ--VILGQDVAQNQSESA-IEPRIVGGIKAKQGQFPHQISLRLRGEHYCGG 64
            :||.|     |.||:  :.|.:.|..:...|| ...|||||......|||:|:|||..|.|.||.
Mosquito     5 ILLSLFVAGALAGVEESIWLSKQVRLDAGTSAEYNGRIVGGSTVPISQFPYQLSLRQNGNHICGA 69

  Fly    65 VIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAV 128
            .:||:...::|.||.   ..:..|...|.:.||...:..||....|::|.||.|.:.. :||:.|
Mosquito    70 SVISSNWALSAAHCT---FPMPSAASISFRGGSDSRTGGGVIFQAAQIINHPQYNSNNLNNDVCV 131

  Fly   129 LRLQSPLTFDANIAAIQLATEDPPNCVAVD--ISGWGNIAEKGPLSDSLLFVQVTSISRGAC--R 189
            :|:.:... .||||.|:|...........:  :||||..:..|.|..:|..|.:..:::..|  :
Mosquito   132 IRITTSFV-GANIAPIRLVASGTSFAAGTNSVVSGWGLTSPGGSLPVNLHAVNIPVVAQATCSSQ 195

  Fly   190 WMFYSRLPETMICL-LHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG--CGRAAPDGYLRISK 251
            | ...|:...|:|. :..::|  |.||||||...||...|:.|   .|.  ||...|..|..|..
Mosquito   196 W-GTGRITAAMVCAGVQGRDS--CNGDSGGPLVTGGAQFGVVS---WGAVQCGGPLPGVYANIGN 254

  Fly   252 --VRAWIAEKAGL 262
              :|::|::..|:
Mosquito   255 AGIRSFISQNTGV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 74/229 (32%)
Tryp_SPc 37..219 CDD:238113 60/187 (32%)
AgaP_AGAP001249XP_001689375.2 Tryp_SPc 41..254 CDD:214473 73/222 (33%)
Tryp_SPc 42..264 CDD:238113 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.