DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP001251

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001689373.2 Gene:AgaP_AGAP001251 / 5667665 VectorBaseID:AGAP001251 Length:290 Species:Anopheles gambiae


Alignment Length:235 Identity:65/235 - (27%)
Similarity:102/235 - (43%) Gaps:25/235 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLL 99
            |.|.||.......:|:|:||||.|.|.||..:|:....::|.||:...  :.|:.: :.:.|:..
Mosquito    62 PFIFGGESVAIESYPYQLSLRLEGTHICGASVIAERWALSAAHCLDEA--LYPSAI-TFRGGTPH 123

  Fly   100 LSSDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQLATEDP--PNCVAVDISG 161
            ..:.|........::||.:.....: |::|..::.....|. |.|:.||..:.  |...|..::|
Mosquito   124 RLAGGYIFHAEYYLLHPKFDRRTLDYDVSVTHVRESFFIDP-IRAVTLANTNTYYPIPSAAVVTG 187

  Fly   162 WGNIAEKG--PLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSG-----ACYGDSGGP 219
            ||.....|  ||  .|..:::....:..|.......|.:..||    ..||     .||||||||
Mosquito   188 WGLADADGYEPL--ILQSLEIYLQQKQFCWTSTIEALTDRQIC----GGSGVYGKETCYGDSGGP 246

  Fly   220 ATYGGKVVGLASLLLGG-GCGRAAPDGYLRIS--KVRAWI 256
            ....|..||:.|  .|. .|....|..|..::  :|||:|
Mosquito   247 LVMNGYQVGIVS--WGSDNCAVNIPGIYTSLTNDEVRAFI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/232 (27%)
Tryp_SPc 37..219 CDD:238113 50/191 (26%)
AgaP_AGAP001251XP_001689373.2 Tryp_SPc 64..277 CDD:214473 60/224 (27%)
Tryp_SPc 64..277 CDD:238113 60/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.